PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_09379A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 162aa    MW: 18063.8 Da    PI: 10.8384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_09379AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.84.5e-07442148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEd l  + ++++G g       +++  R++ +c+srw++yl
  Oropetium_20150105_09379A  4 KGKWSKEEDYLMRNHIEKHGIG-------RLQ--RCGRSCRSRWLNYL 42
                               79******************99.......777..************97 PP

2Myb_DNA-binding37.36.4e-124992247
                               SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               g++T+ Ed+++ d   + G+  W+ Ia+ ++ gRt+  +k++w++ 
  Oropetium_20150105_09379A 49 GNFTPAEDKIICDMYSKRGSC-WSVIAAQLP-GRTDLAIKNYWNST 92
                               89*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.334142IPR017930Myb domain
SMARTSM007170.0022344IPR001005SANT/Myb domain
SuperFamilySSF466897.81E-23389IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-13549IPR009057Homeodomain-like
CDDcd001674.05E-5642No hitNo description
PROSITE profilePS5129418.9014397IPR017930Myb domain
SMARTSM007174.0E-104795IPR001005SANT/Myb domain
PfamPF002492.5E-104992IPR001005SANT/Myb domain
CDDcd001673.62E-75093No hitNo description
Gene3DG3DSA:1.10.10.607.3E-225096IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MMKKGKWSKE EDYLMRNHIE KHGIGRLQRC GRSCRSRWLN YLRPGLKHGN FTPAEDKIIC  60
DMYSKRGSCW SVIAAQLPGR TDLAIKNYWN STLKKRFPAA RTSAAAAAHR KPRPSPTSST  120
SSDAGTPSGT TIFGASTCIL RELNSRAKMG LDNKTEMLRC N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-2329725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661280.18e-63PREDICTED: transcription factor RAX2-like
SwissprotQ9FKL24e-36MYB36_ARATH; Transcription factor MYB36
TrEMBLK4AED72e-58K4AED7_SETIT; Uncharacterized protein
STRINGSi037244m5e-58(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122282638
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37780.14e-39myb domain protein 87